Interleukin 1β (IL 1β) can also be called as IL-1, IL1F2, IL1beta, IL1-BETA.
Specifications Of P01I0053 Human IL 1β Protein, Recombinant
Porduct's Information Porduct's Information | |
CatalogNumber | P01I0053 |
Package Size | 10ug/50ug/100ug/1mg |
Other Names | IL-1; IL1F2; IL1beta; IL1-BETA |
Protein & NCBI Number | P01584, NM_000576.3 |
Host | E.coli |
Express Region | 1-269aa |
Protein Length | Total length of the protein(including Tag) |
Protein Sequence | MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS |
Molecular Weight | about30.7kDa |
Fusion Tag | 6×His-SUMO (N-terminus) |
Purity | ≥95% SDS-PAGE |
PhysicalProperty | liquid or lyophilized powder |
Reconstitution | Storage solution: We recommend using PBS or a suitable solvent according to the experimental requirements to prepare 1mg/mL storage solution, aliquot and store at -20 °C. Working solution: According to the experimental requirement, dilute Storage solution. The working solution can be stored at 4°C for 2-3 weeks after dilution. |
Storage & Stability | The shelf life of liquid form is 6 months stored at -20 °C /-80 °C. The shelf life of lyophilized form is 12 months stored at -20 °C /-80 °C. |
Applications | Antibody preparation, immunoassay (ELISA, WB), subcellular localization and interaction protein identification, etc. |
Lead Time | 5 to 10 business days; 2 to 3 days for stock products |
Background |
Interleukin IL-1β also known as catabolin, is a member of the interleukin 1 cytokine family. IL1B, the cytokine encoded by the IL1B gene, is an inflammatory response and fever mediator, and contributes to several lymphocyte activities including growth and differentiation of B-cells, proliferation of T-helper Type2 (Th2) clones, and activation of Th17 cells. IL-1β is produced in peripheral blood mononuclear cells, tissue macrophages, and dendritic fine cells in response to immune responses, inflammation, infection, and trauma cells such as cytium. IL1B is required for T-cell activation in some immune responses, and thus could contribute to increased T-cell replication. IL-1β can also act on distant target cells in an endocrine manner to induce systemic immune response. IL-1β can rapidly induce the expression of cytokines such as IL-6 and IL-8 of various cell types. At the same time, IL-1β also induces its own expression, forming a positive feedback loop and amplifying the IL-1 response. |