Name: P01F0008 Human Fibroblast Growth Factor 17(FGF17) Protein, Recombinant
Brand: Shanghai BlueGene Biotech CO., LTD.

P01F0008 Human Fibroblast Growth Factor 17(FGF17) Protein, Recombinant

Fibroblast Growth Factor 17(FGF17) can also be called HH20, FGF-13, FGF-17.

Products

Specifications Of P01F0008 Human FGF17 Protein, Recombinant

Porduct's Information
CatalogNumber	P01F0008
Package Size	10ug/50ug/100ug/1mg
Other Names	HH20; FGF-13; FGF-17
Protein & NCBI Number	O60258, NM_003867.4
Host	E.coli
Express Region	1-216aa
Protein Length	Total length of the protein（including Tag）
Protein Sequence	MGAARLLPNLTLCLQLLILCCQTQGENHPSPNFNQYVRDQGAMT DQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGA ESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPR QASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT
Molecular Weight	about 24.9kDa
Fusion Tag	6×His-SUMO (N-terminus)
Purity	≥95% SDS-PAGE
PhysicalProperty	liquid or lyophilized powder
Reconstitution	Storage solution: We recommend using PBS or a suitable solvent according to the experimental requirements to prepare 1mg/mL storage solution, aliquot and store at -20 °C. Working solution: According to the experimental requirement, dilute Storage solution. The working solution can be stored at 4°C for 2-3 weeks after dilution.
Storage & Stability	The shelf life of liquid form is 6 months stored at -20 °C /-80 °C. The shelf life of lyophilized form is 12 months stored at -20 °C /-80 °C.
Applications	Antibody preparation, immunoassay (ELISA, WB), subcellular localization and interaction protein identification, etc.
Lead Time	5 to 10 business days; 2 to 3 days for stock products

Background

FGF17 is a member of fibroblast growth factor family It is mainly located in the developing brain tissue. This protein is expressed during embryogenesis and in the adult cerebellum and cortex. FGF17 is an irreplaceable cytokine and has a variety of biological functions. It plays an important regulatory role, and has important biological significance for the formation and development of embryonic nervous system, bone and blood vessels. As a potential carcinogenic factor, FGF17 is involved in the occurrence, development and metastasis of various cancers. It provides clues for studying the pathogenesis and treatment of cancer, such as the treatment of breast cancer and leukemia.

Member of the FGF family possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes including embryonic development cell growth, morphogenesis, tissue repair, tumor growth and invasion. FGF17 carries out cell signal transduction by binding to FGF receptor.