En
Email
  • tmao elisa kit
  • tmao elisa kit

BlueGene Biotech P01I0001 Human Interferon γ (IFN γ) Protein, Recombinant

Interferon γ (IFN γ) can also be called as IFG, IFI, IMD69.

Specifications Of P01I0001 Human IFN γ Protein, Recombinant

Porduct's Information

Catalog Number

P01I0001

Package Size

10ug/50ug/100ug/1mg

Other Names

IFG; IFI; IMD69

Protein & NCBI Number

P01579, NM_000619.3

Host

E.coli

Express Region

1-166aa

Protein Length

The total length of the protein(including Tag)

Protein Sequence

MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSD                     

VADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNV                     

KFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFR                     

GRRASQ

Molecular Weight

about 19.3kDa

Fusion Tag

6×His-SUMO (N-terminus)

Purity

≥95% SDS-PAGE

Physical Property

liquid or lyophilized powder

Reconstitution

Storage solution: We recommend using PBS or a suitable solvent according to the experimental requirements to prepare 1mg/mL storage solution, aliquot and store at -20 °C.

Working solution: According to the experimental requirement, dilute the Storage solution. The working solution can be stored at 4°C for 2-3 weeks after dilution.

Storage & Stability

The shelf life of liquid form is 6 months stored at -20 °C /-80 °C.

The shelf life of lyophilized form is 12 months stored at -20 °C /-80 °C.

Applications

Antibody preparation, immunoassay (ELISA, WB), subcellular localization and interaction protein identification, etc.

Lead Time

5 to 10 business days;

2 to 3 days for stock products


Background

IFNG gene encodes a soluble cytokine that is a member of the type II interferon class. The active protein is a homodimer that binds to the interferon gamma receptor which triggers a cellular response to viral and microbial infections. It has the functions of anti-virus, affecting cell growth and differentiation, anti-tumor, anti parasite and immune regulation.

Interferon- γ (interferon-gamma, IFN- γ) It is a cytokine mainly secreted by activated T cells and NK cells under the stimulation of mitogen and specific antigen. It is also a soluble glycoprotein, heat-resistant and acid, which is unstable at pH = 2. IFN- γ It can not only affect the cellular functions including anti-virus, anti swelling, cancer cell growth and differentiation, but also play an important role in immune regulation, such as promoting the synthesis of rRNA, promoting the expression of class I and class II histocompatibility antigens, and regulating the functional activity of homologous K cells, NK cells and macrophages. IFN- γ It also has antiviral activity, which is lower than type I, but it has strong immune regulation and anti cell proliferation, so it is also called immune interferon.


BlueGene Biotech Product Show

Related Bluegene Biotech Products

Join us and become BlueGene's distributor, you will get a broad range of Life science research products and more than 12 years of experienced technical supports.