SUMO protease 1 can also be called as NIB1, Ulp1.
Specifications Of PGEU0001 Ulp1 (SUMO protease 1), Recombinant
Porduct's Information | |
CatalogNumber | PGEU0001 |
Package Size | 10ug/50ug/100ug/1mg |
Other Names | NIB1; Ulp1; |
Protein & NCBI Number | Q02724, NM_001183834.1 |
Host | E.coli |
Express Region | 401-621aa |
Protein Length | 230aa(including Tag) |
Protein Sequence | MKKLVPELNEKDDDQVQKALASRENTQLMNRDNIEITVRDFKTLAPRRWLNDTIIEFFMKYIEKSTPNTVAFNSFFYTNLSERGYQGVRRWMKRKKTQIDKLDKIFTPINLNQSHWALGIIDLKKKTIGYVDSLSNGPNAMSFAILTDLQKYVMEESKHTIGEDFDLIHLDCPQQPNGYDCGIYVCMNTLYGSADAPLDFDYKDAIRMRRFIAHLILTDALKLEHHHHHH |
Molecular Weight | About 26.9kDa |
Fusion Tag | 6×His(C-terminus) |
Purity | ≥95% SDS-PAGE |
PhysicalProperty | liquid or lyophilized powder |
Reconstitution | Storage solution: We recommend using PBS or a suitable solvent according to the experimental requirements to prepare 1mg/mL storage solution, aliquot and store at -20 °C. Working solution: According to the experimental requirement, dilute Storage solution. The working solution can be stored at 4°C for 2-3 weeks after dilution. |
Storage & Stability | The shelf life of liquid form is 6 months stored at -20 °C /-80 °C. The shelf life of lyophilized form is 12 months stored at -20 °C /-80 °C. |
Applications | Antibody preparation, immunoassay (ELISA, WB), Cleaves the SUMO tag at the N terminus of the fusion protein, etc. |
Lead Time | 5 to 10 business days; 2 to 3 days for stock products |
Background |
ULP1 also known as Ubiquitin-like-specific protease 1,Smt3-protein conjugate proteinase,Ulp1 endopeptidase, it is mainly sourced Saccharomyces cerevisiae (strain ATCC 204508/S288c), it includes three domains: ULP1, Peptidase-C48 and PLN03189. Catalytic Activity: Hydrolysis of the alpha-linked peptide bond in the sequence Gly-Gly-|-Ala-Thr-Tyr at the C-terminal end of the small ubiquitin-like modifier (SUMO) propeptide, Smt3, leading to the mature form of the protein. A second reaction involves the cleavage of an epsilon-linked peptide bond between the C-terminal glycine of the mature SUMO and the lysine epsilon-amino group of the target protein. |
BlueGene Biotech Product Show
Related Products Of Ulp1 (SUMO protease 1), Recombinant
N/A