SUMO protease can also be called as NIB1, Ulp1.
Specifications Of PGEU0001 Ulp1 (SUMO protease 1), Recombinant
Product Information | |
Catalog Number | PGEU0001 |
Package Size | 10ug/50ug/500ug/1mg |
Other Names | NIB1; Ulp1 |
Protein & NCBI Number | Q02724, NM_001183834.1 |
Host | E.coli |
Express Region | Lys401-Lys621 |
Protein Sequence | KKLVPELNEKDDDQVQKALASRENTQLMNRDNIEITVRDFKTLAPRRWLNDTIIEFFMKYIE |
Molecular Weight | The protein consists of 230 amino acids (including the fusion tag), with a |
Fusion Tag | 6×His(C-terminus) |
Purity | ≥85% SDS-PAGE |
Physical Property | Liquid |
| Components | 0.01M PBS+20% glycerol, sterile solution |
Storage & Stability | After aliquoting, the stability of the samples can be maintained for up to 6 |
Applications | Antibody preparation, immunoassay (ELISA, WB), Cleaves the SUMO tag at the |
Lead Time | 5 to 10 business days; 2 to 3 days for stock products |
Background |
ULP1 also known as Ubiquitin-like-specific protease 1，Smt3-protein conjugate proteinase,Ulp1 endopeptidase, it is mainly sourced Saccharomyces cerevisiae (strain ATCC 204508/S288c), it includes three domains: ULP1, Peptidase-C48 and PLN03189. Catalytic Activity: Hydrolysis of the alpha-linked peptide bond in the sequence Gly-Gly-|-Ala-Thr-Tyr at the C-terminal end of the small ubiquitin-like modifier (SUMO) propeptide, Smt3, leading to the mature form of the protein. A second reaction involves the cleavage of an epsilon-linked peptide bond between the C-terminal glycine of the mature SUMO and the lysine epsilon-amino group of the target protein. |
BlueGene Biotech Product Show
Related Products Of Ulp1 (SUMO protease 1), Recombinant
N/A
