Name: P01I0420P Human Long arginine 3-IGF-1 (IGF1-LR3) Protein, Recombinant
Brand: Shanghai BlueGene Biotech CO., LTD.
Price: 100 USD

BlueGene Biotech P01I0420P Human Long arginine 3-IGF-1 (IGF1-LR3) Protein, Recombinant

Immunology

Long arginine 3-IGF-1 (IGF1-LR3) can also be called Mechano growth factor (MGF)，Somatomedin-C，IGF1，IGF-I，IGF1A，IGFI.

Products

Specifications of P01I0420P Human Long arginine 3-IGF-1 (IGF1-LR3) Protein, Recombinant

Product Information
catalog number	P01I0420P
Package Size	10ug/50ug/500ug/1mg
Other Names	Mechano growth factor (MGF)，Somatomedin-C，IGF1，IGF-I，IGF1A，IGFI
Protein & NCBI Number	P05019, NM_000618
Host	E.coli
Express Region	Gly49-Ala118
Protein Sequence	GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Molecular Weight	The protein molecule consists of 70 amino acids (including the fusion tag), with a predicted molecular weight of 7.7 kDa, which matches the predicted molecular weight
Fusion Tag	None
Purity	≥90% SDS-PAGE
Physical Property	Liquid
Components	0.01M PBS+20% glycerol, sterile solution
Storage & Stability	After aliquoting, the stability of the samples can be maintained for up to 6 months at -20°C to -80°C, avoiding repeated freeze-thaw cycles.
Applications	Antibody preparation, immunoassay (ELISA, WB), subcellular localization and interaction protein identification, etc.
Lead Time	5 to 10 business days; 2 to 3 days for stock products

Background

Insulin-like Growth Factor 1 (IGF-1), also known as somatomedin C, is a protein encoded by the human gene IGF1.

Due to its unregulated insulin-like activity, it is also referred to as nonsuppressible insulin-like activity (NSILA). The IGF-1 protein consists of a single peptide chain composed of 70 amino acid residues and three intramolecular disulfide bonds, with a molecular weight of 7,649 daltons, and it can be secreted into the extracellular space. Originally isolated from plasma, it shares structural and functional similarities with insulin but possesses greater growth-promoting activity. It stimulates glucose transport in osteoblasts and is more efficient than insulin in DNA and glycogen synthesis and uptake. It acts as a ligand for IGF1R, binding to its α subunit and initiating tyrosine phosphorylation on tyrosine residues of the β subunit of tyrosine
kinase, thereby activating downstream PI3K-AKT/PKB and Ras-MAPK pathways.