En
Email
  • tmao elisa kit
  • tmao elisa kit

BlueGene Biotech P01F0002 Human Fibroblast Growth Factor 2 (FGF2) Protein, Recombinant

Fibroblast Growth Factor 2 (FGF2) can also be called BFGF, FGFB, FGF-2, HBGF-2.

Specifications Of P01F0002 Human FGF2 Protein, Recombinant

Porduct's Information

CatalogNumber

P01F0002

Package Size

10ug/50ug/100ug/1mg

Other Names

BFGF; FGFB; FGF-2; HBGF-2

Protein & NCBI Number

D9ZGF5, NM_001361665.2

Host

E.coli

Express Region

1-155aa

Protein Length

Total length of the protein(including Tag)

Protein Sequence

MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIH

PDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECF

FFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Molecular Weight

about 17.3kDa

Fusion Tag

6×His-SUMO (N-terminus)

Purity

≥95% SDS-PAGE

PhysicalProperty

liquid or lyophilized powder

Reconstitution

Storage solution: We recommend using PBS or a suitable solvent according to the experimental requirements to prepare 1mg/mL storage solution, aliquot and store at -20 °C.

Working solution: According to the experimental requirement, dilute Storage solution. The working solution can be stored at 4°C for 2-3 weeks after dilution.

Storage & Stability

The shelf life of liquid form is 6 months stored at -20 °C /-80 °C.

The shelf life of lyophilized form is 12 months stored at -20 °C /-80 °C.

Applications

Antibody preparation, immunoassay (ELISA, WB), subcellular localization and interaction protein identification, etc.

Lead Time

5 to 10 business days;

2 to 3 days for stock products



Background

FGF-2, also known as basic fibroblast growth factor (bFGF), is an important member of fibroblast growth factor (FGF) family. FGF-2 is a cationic polypeptide with a molecular weight of 16 ~ 18000 and an isoelectric point of 9.6. FGF2 can be produced by vascular endothelial cells, retinal pigment epithelial cells, photoreceptor cells, m ü ller cells and astrocytes. It widely exists in a variety of tissues in vivo and mainly plays a role through autocrine and paracrine. The signal pathway induced by FGF2 is necessary for normal cell growth and differentiation. It exists in almost all cells. FGF2 binds to FGFR, which makes the receptor dimerize and tyrosine kinase is activated, triggering a series of intracellular phosphorylation cascade reactions to regulate cell growth Differentiation and apoptosis. Under normal conditions, FGF-2 binds to heparin and does not produce biological effects. However, in some pathological cases, the integrity of cells is destroyed, which can release the stored form of FGF-2, promote angiogenesis and participate in the process of tissue repair. FGF-2 and FGFR are almost distributed in various tissues of the whole body. FGF-2 is the strongest known cytokine. It plays an important role in promoting angiogenesis, wound healing, tissue injury repair, neuroprotection, embryonic development and tumor formation. FGF-2 has two main functions, inducing endothelial cell germination and proliferation and increasing vascular permeability. In addition, studies have shown that FGF2 is also closely related to depression.


BlueGene Biotech Product Show

Related Bluegene Biotech Products

Join us and become BlueGene's distributor, you will get a broad range of Life science research products and more than 12 years of experienced technical supports.