Fibroblast Growth Factor 9 (FGF9) can also be called GAF, HBFG-9, HBGF-9, SYNS3.
Specifications Of P01F0073P-T2 Human Fibroblast Growth Factor 9 (FGF9) Protein, Recombinant
| Product Information | |
Catalog Number | P01F0073P-T2 |
Package Size | 10ug/50ug/500ug/1mg |
Other Names | GAF, HBFG-9, HBGF-9, SYNS3 |
Protein & NCBI Number | P31371, NP_002001.1 |
Host | E.coli |
Express Region | Met1-Ser208 |
Protein Sequence | MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTD |
Molecular Weight | The protein consists of 357 amino acids (including the fusion tag), with a predicted molecular weight of 39.9kDa and an actual molecular weight of approximately 42 kDa. |
Fusion Tag | 6×His-SUMO (N-terminus） |
Purity | ≥95% SDS-PAGE |
Physical Property | Liquid |
components | 0.01M PBS+20% glycerol, sterile solution. |
Storage & Stability | After aliquoting, the stability of the samples can be maintained for up to 6 months at -20°C to -80°C, avoiding repeated freeze-thaw cycles. |
Applications | Antibody preparation, immunoassay (ELISA, WB), subcellular localization and interaction protein identification, etc. |
Lead Time | 5 to 10 business days; 2 to 3 days for stock products |
| Bioactivity | .jpg "HuFGF2_有标(1).jpg"){kind=small} .jpg "HuFGF2_有标(3).jpg") |
Background |
FGF family members exhibit extensive mitogenic and cell survival activities, playing roles in various biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. FGF9, as a secreted factor, was isolated and shown to stimulate growth in cultured glial cells. In the nervous system, FGF9 is primarily produced by neurons and may play an important role in the development of glial cells. In vivo, FGF9 is involved in processes such as cell proliferation, differentiation, and developmental regulation. It plays critical roles in neurodevelopment, angiogenesis, skeletal development, as well as muscle and cartilage repair. Additionally, it has the ability to promote angiogenesis, wound healing, and tissue regeneration. The role of FGF9 in sex determination begins with its expression in the bipotential gonads. Once activated by SOX9, FGF9 forms a feedforward loop with SOX9, thereby increasing the levels of both genes. This positive feedback loop upregulates SOX9 and simultaneously inactivates the female Wnt4 signaling pathway. |
Related Products Of Human Fibroblast Growth Factor 9 (FGF9) Protein, Recombinant
P01F0003P Human Fibroblast Growth Factor 2 (FGF2) Protein, Recombinant
P01F0003P-T2 Human Fibroblast Growth Factor 2 (FGF2) Protein, Recombinant
P01I0420P-T2 Human Insulin-like Growth Factor 1 Long R3 Analog (IGF1-LR3) Protein, Recombinant
P01E0032P Human Epidermal Growth Factor (EGF) Protein, Recombinant
P01V0016E-T3 Human Vascular endothelial growth factor 165 (VEGF165) Protein, Recombinant
P01I0420P Human Insulin-like Growth Factor 1 Long R3 Analog (IGF1-LR3) Protein, Recombinant
P01E0032P-T2 Human Epidermal Growth Factor (EGF) Protein, Recombinant
P01F0221P-T2 Human Fibroblast Growth Factor 10 (FGF10) Protein, Recombinant
