Name: P01I0006P-T2 Human Interleukin-6 (IL-6) Protein, Recombinant
Brand: Shanghai BlueGene Biotech CO., LTD.
Price: 100 USD

BlueGene Biotech P01I0006P-T2 Human Interleukin-6 (IL-6) Protein, Recombinant

Immunology

Cardiovascular

Interleukin-6 (IL-6) can also be called CDF; HGF; HSF; BSF2; IL-6; BSF-2; IFNB2; IFN-beta-2

Products

Specifications of P01I0006P-T2 Human Interleukin-6 (IL-6) Protein, Recombinant

Product Information
catalog number	P01I0006P-T2
Package Size	10ug/50ug/500ug/1mg
Other Names	CDF; HGF; HSF; BSF2; IL-6; BSF-2; IFNB2; IFN-beta-2
Protein & NCBI Number	P05231, NM_000600.5
Host	E.coli
Express Region	Met1-Met212
Protein Sequence	MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISA LRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQ NRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTT HLILRSFKEFLQSSLRALRQM
Molecular Weight	The protein consists of 338 amino acids (including the fusion tag), with a predicted molecular weight of 38.0kDa, which matches the actual molecular weight.
Fusion Tag	6×His-SUMO (N-terminus)
Purity	≥95% SDS-PAGE
Physical Property	Liquid
Components	0.01M PBS+20% glycerol, sterile solution
Storage & Stability	After aliquoting, the stability of the samples can be maintained for up to 6 months at -20°C to -80°C, avoiding repeated freeze-thaw cycles
Applications	Antibody preparation, immunoassay (ELISA, WB), subcellular localization and interaction protein identification, etc
Lead Time	5 to 10 business days; 2 to 3 days for stock products

Background

IL-6 gene encodes a cytokine that functions in inflammation and the maturation of B cells. In addition, the encoded protein has been shown to be an endogenous pyrogen capable of inducing fever in people with autoimmune diseases or infections. The protein is primarily produced at sites of acute and chronic
inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of
this gene is implicated in a wide variety of inflammation-associated disease states, including susceptibility to diabetes mellitus and systemic juvenile rheumatoid arthritis. Elevated levels of the encoded protein have been found in virus infections, including COVID-19 (disease caused by SARS-CoV-2).