Name: P01I0310P-T1 Human Interleukin 18 (IL-18) Protein, Recombinant
Brand: Shanghai BlueGene Biotech CO., LTD.
Price: 100 USD

BlueGene Biotech P01I0310P-T1 Human Interleukin 18 (IL-18) Protein, Recombinant

Immunology

Neuroscience

Cancer

Metabolism

Interleukin 18 (IL-18) can also be called IGIF; IL-18; IL-1g; IL1F4.

Products

Specifications of P01I0310P-T1 Human Interleukin 18 (IL-18) Protein, Recombinant

Product Information
catalog number	P01I0310P-T1
Package Size	10ug/50ug/500ug/1mg
Other Names	IGIF; IL-18; IL-1g; IL1F4
Protein & NCBI Number	NM_001562, Q14116
Host	E.coli
Express Region	Met1-Asp193
Protein Sequence	MGSSHMASMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQG KEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGMAAEPVEDNCINFVAMKFIDNTLYFIA EDDENLESDYFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPR GMAVTISVKCEKISTLSCENKIISFKEMNPPDNIKDTKSDIIFFQRSVPGHDNKMQFESSSYEGYFLAC EKERDLFKLILKKEDELGDRSIMFTVQNEDKHHHHHH
Molecular Weight	The protein consists of 306 amino acids (including the fusion tag), with a predicted molecular weight of 35.31kDa, and an actual molecular weight is 34.5kDa
Fusion Tag	SUMO(N-terminus), 6×His (C-terminus)
Purity	≥90% SDS-PAGE
Physical Property	Liquid
Components	0.01M PBS+20% glycerol, sterile solution
Storage & Stability	After aliquoting, the stability of the samples can be maintained for up to 6 months at -20°C to -80°C, avoiding repeated freeze-thaw cycles.
Applications	Antibody preparation, immunoassay (ELISA, WB), subcellular localization and interaction protein identification, etc.
Lead Time	5 to 10 business days; 2 to 3 days for stock products

Background

Interleukin-18 belongs to the interleukin-1 family. Interleukin 18 (IL-18) is a potent pro-inflammatory cytokine that can induce the production of interferon-γ (IFN-γ) by Th1 cells, natural killer (NK) cells, and activated macrophages, particularly in the presence of IL-12. IL-18 also participates in regulating the development of T lymphocyte helper type I cells and Fas-mediated cytotoxicity. Inhibition of IL-18 activity is being investigated as a therapeutic approach for the treatment of chronic inflammatory diseases such as Crohn's disease and rheumatoid arthritis. It operates by inducing heterodimerization of its receptors, IL-18RAlpha and IL-18RBeta, which is structurally similar to IL-1.

The regulatory mechanism of Interleukin-18 is very complex, and its production is modulated by a variety of signaling pathways. Cytokines such as Tumor Necrosis Factor (TNF) and Interleukin (IL-1) can stimulate the production of interleukin-18. Additionally, the Toll-like receptor (TLR) signaling pathway and the NLRP3 Inflammasome are also involved in the regulation of Interleukin-18. Furthermore, certain transcription factors, such as NF-κB and AP-1, can directly or indirectly influence the production of interleukin-18.