Name: P01I0383P-T2 Human Interleukin 3 (IL-3) Protein, Recombinant
Brand: Shanghai BlueGene Biotech CO., LTD.
Price: 100 USD

BlueGene Biotech P01I0383P-T2 Human Interleukin 3 (IL-3) Protein, Recombinant

Immunology

Interleukin 3 (IL-3) can also be called interleukin 3, IL-3, MCGF, MULTI-CSF.

Products

Specifications of P01I0383P-T2 Human Interleukin 3 (IL-3) Protein, Recombinant

Product Information
catalog number	P01I0383P-T2
Package Size	10ug/50ug/500ug/1mg
Other Names	interleukin 3, IL-3, MCGF, MULTI-CSF
Protein & NCBI Number	NM_000588.4, P08700
Host	E.coli
Express Region	Ala20-Phe152
Protein Sequence	APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFN RAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Molecular Weight	The protein consists of 254 amino acids (including the fusion tag), with a predicted molecular weight of 28.8 kDa, which matches the actual molecular weight
Fusion Tag	6×His-SUMO (N--terminus)
Purity	≥60% SDS-PAGE
Physical Property	Liquid
Components	0.01M PBS+20% glycerol, sterile solution
Storage & Stability	After aliquoting, the stability of the samples can be maintained for up to 6 months at -20°C to -80°C, avoiding repeated freeze-thaw cycles.
Applications	Antibody preparation, immunoassay (ELISA, WB), subcellular localization and interaction protein identification, etc.
Lead Time	5 to 10 business days; 2 to 3 days for stock products

Background

Interleukin-3 (IL-3), also known as Multicolony Stimulation Factor (Multi-CSF), has been referred to by various names, including Burst-Promoting Activity, WHE I-3 Factor, Mast Cell Growth Factor, Histamine-Stimulated Cell Growth Factor, P Cell-Stimulating Factor, and Pluripotent Colony-Stimulating Factor.

IL-3 is primarily produced by activated T cells and NK cells. Additionally, IL-3 can be generated by human endothelial cells activated by IL-1, murine mast cells activated by IgE, and placental cells. Its main function is to promote the directed differentiation and proliferation of multipotent hematopoietic stem cells in the bone marrow, leading to the generation of various types of blood cells. Furthermore, IL-3 regulates the growth, differentiation, and related gene expression of various mature cells, such as the c-myc and IL-2Rα genes.