Name: P01I0383P Human Interleukin 3 (IL3) Protein, Recombinant
Brand: Shanghai BlueGene Biotech CO., LTD.
Price: 100 USD

BlueGene Biotech P01I0383P Human Interleukin 3 (IL3) Protein, Recombinant

Immunology

Cancer

Interleukin 3 (IL3) can also be called interleukin 3, IL-3, MCGF, MULTI-CSF.

Products

Specifications of P01I0383P Human Interleukin 3 (IL3) Protein, Recombinant

Product Information
catalog number	P01I0383P
Package Size	10ug/50ug/500ug/1mg
Other Names	interleukin 3, IL-3, MCGF, MULTI-CSF
Protein & NCBI Number	NM_000588.4, P08700
Host	E.coli
Express Region	Ala20-Phe152
Protein Sequence	APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLR RPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRK LTFYLKTLENAQAQQTTLSLAIF
Molecular Weight	The protein consists of 133 amino acids, with a predicted molecular weight of 15.1kDa, and the actual molecular weight is 13kDa
Fusion Tag	None
Purity	≥90% SDS-PAGE
Physical Property	Liquid
Components	0.01M PBS+20% glycerol, sterile solution
Storage & Stability	After aliquoting, the stability of the samples can be maintained for up to 6 months at -20°C to -80°C, avoiding repeated freeze-thaw cycles.
Applications	Antibody preparation, immunoassay (ELISA, WB), subcellular localization and interaction protein identification, etc.
Lead Time	5 to 10 business days; 2 to 3 days for stock products

Background

Interleukin-3 (IL-3), also known as Multicolony Stimulating Factor (Multi-CSF), has been referred to by various names in earlier studies, including Burst-promoting Activity (BPA),
WEHI-3 Factor, Mast Cell Growth Factor(distinct from stem cell factor, SCF), Histamine-stimulated Cell Growth Factor, P-cell Stimulating Factor, and Pluripotent Colony-stimulating Factor.

IL-3 is primarily produced by activated T cells and NK cells. Additionally, IL-1-activated human endothelial cells, IgE-activated murine mast cells, and placental cells can also pruduce IL-3.
Its primary function is to stmulate the proliferation and lineage-specific differentiation of multipotent hematopoietic stem cells in the bone marrow, thereby generating various types of
blood cells. Furthermore, IL-3 plays a regulatory role in the growth, differentiation, and gene expression of multiple mature cell types, including genes such as c-myc and IL-2Rα.