Name: P01I0357P-T1 Human Interleukin 15 (IL-15) Protein, Recombinant
Brand: Shanghai BlueGene Biotech CO., LTD.
Price: 100 USD

BlueGene Biotech P01I0357P-T1 Human Interleukin 15 (IL-15) Protein, Recombinant

Immunology

Cardiovascular

Interleukin 15 (IL-15) can also be called Interleukin-15.

Products

Specifications of P01I0357P-T1 Human Interleukin 15 (IL-15) Protein, Recombinant

Product Information
catalog number	P01I0357P-T1
Package Size	10ug/50ug/500ug/1mg
Other Names	Interleukin-15
Protein & NCBI Number	P40933
Host	E.coli
Express Region	Ala29-Ser162
Protein Sequence	MGSSHMASMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAK RQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGAGIHVFILGCFSAGLPKT EANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDT VENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTSKHHHHHH
Molecular Weight	The protein consists of 247 amino acids (including the fusion tag), with a predicted molecular weight of 27.77 kDa, which matches the actual molecular weight
Fusion Tag	SUMO(N-terminus), 6×His (C-terminus)
Purity	≥90% SDS-PAGE
Physical Property	Liquid
Components	0.01M PBS+20% glycerol, sterile solution
Storage & Stability	After aliquoting, the stability of the samples can be maintained for up to 6 months at -20°C to -80°C, avoiding repeated freeze-thaw cycles
Applications	Antibody preparation, immunoassay (ELISA, WB), subcellular localization and interaction protein identification, etc
Lead Time	5 to 10 business days; 2 to 3 days for stock products

Background

Interleukin-15 (IL-15) is a T-cell growth factor discovered in 1994 by two independent laboratories and shares similar biological functions with IL-2. IL-15 is a pleiotropic cytokine primarily secreted by monocytes and macrophages, and its mRNA is expressed in a variety of cells and tissues in the human body, such as the heart, lungs, kidneys, muscle, and placenta. Nevertheless, IL-15 expression is most abundant in adherent peripheral blood monocytes, fibroblasts, and epithelial cells.

The IL-15 gene is located on human chromosome 4q31 and consists of 9 exons and 8 introns. Four of these exons (from the 5th to the 8th exon) encode the mature protein, which has a molecular weight of approximately 14-15 kDa. The cell sources and target cell distribution of IL-15 are broader than those of IL-2, suggesting that it may exert effects similar to IL-2 in tissues where IL-2 is not expressed.

IL-15 (Interleukin-15) and IL-2 (Interleukin-2) are both crucial cytokines that play multifaceted roles in the immune system. IL-15 and IL-2 share similar functions in regulating the proliferation, development, and survival of T cells and NK cells. However, their roles in B cell immunoglobulin production differ. IL-2 primarily affects T cells, whereas IL-15 has a more pronounced impact on NK cells.