En
Email
  • tmao elisa kit
  • tmao elisa kit

BlueGene Biotech P01I0345P-T2 Human Interferon gamma (IFNγ) Protein, Recombinant

  • Immunology
  • Cancer
  • Stem cells

Interferon gamma (IFNγ) can also be called IFG; IFI; IMD69.

Products

Specifications Of P01I0345P-T2 Human Interferon gamma (IFNγ) Protein, Recombinant

Product Information

Catalog Number

P01I0345P-T2

Package Size

10ug/50ug/500ug/1mg

Other Names

IFG; IFI; IMD69

Protein & NCBI Number

P01579, NM_000619.3

Host

E.coli

Express Region

Met1-Gln166

Protein Sequence

MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVS
FYFKLFKNFKDDQSIQKSVETIKEDMNV KFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAK
TGKRKRSQMLFRGRRASQ

Molecular Weight

The protein consists of 292 amino acids (including the fusion tag), with a predicted molecular weight of 33.7 kDa,
which matches the actual molecular weight

Fusion Tag

6×His-SUMO (N-terminus)

Purity

≥95% SDS-PAGE

Physical Property

Liquid

Components

0.01M PBS+20% glycerol, sterile solution

Storage & Stability

After aliquoting, the stability of the samples can be maintained for up to 6 months at -20°C to -80°C,
avoiding repeated freeze-thaw cycles.

Applications

Antibody preparation, immunoassay (ELISA, WB), subcellular localization and
interaction protein identification, etc.

Lead Time

5 to 10 business days;

2 to 3 days for stock products


Background

IFNG gene encodes a soluble cytokine that is a member of the type II interferon class. The active protein is a homodimer that binds to the interferon gamma receptor which triggers a cellular response to viral and microbial infections. It has the functions of anti-virus, affecting cell growth and differentiation, anti-tumor, anti parasite and immune regulation.

Interferon- γ (interferon-gamma, IFN- γ) It is a cytokine mainly secreted by activated T cells and NK cells under the stimulation of mitogen and specific antigen. It is also a soluble glycoprotein, heat-resistant and acid, which is unstable at pH = 2. IFN- γ It can not only affect the cellular functions including anti-virus, anti swelling, cancer cell growth and differentiation, but also play an important role in immune regulation, such as promoting the synthesis of rRNA, promoting the expression of class I and class II histocompatibility antigens, and regulating the functional activity of homologous K cells, NK cells and macrophages. IFN- γ It also has antiviral activity, which is lower than type I, but it has strong immune regulation and anti cell proliferation, so it is also called immune interferon.


Related Products of Human Interferon gamma (IFNγ) Protein, Recombinant

P01R0005P-T2 Human Receptor activator of nuclear factor kappa B ligand (RANKL) Protein, Recombinant

P01R0005P Human Receptor activator of nuclear factor kappa B ligand (RANKL) Protein, Recombinant

P01G0016P-T2 Human Granulocyte Macrophage Colony Stimulating Factor (GM-CSF) Protein, Recombinant

P01G0016E-T3 Human Granulocyte Macrophage Colony Stimulating Factor (GM-CSF) Protein, Recombinant

P03G0016P-T2 Mouse Granulocyte Macrophage Colony Stimulating Factor (GM-CSF) Protein, Recombinant

P03G0016E-T3 Mouse Granulocyte Macrophage Colony Stimulating Factor (GM-CSF) Protein, Recombinant

P01S0011P Human Stem Cell Factor (SCF) Protein, Recombinant

P01G0016P Human Granulocyte Macrophage Colony Stimulating Factor (GM-CSF) Protein, Recombinant


BlueGene Biotech Product Show

Related Bluegene Biotech Products

Join us and become BlueGene's distributor, you will get a broad range of Life science research products and more than 12 years of experienced technical supports.