En
Email
  • tmao elisa kit
  • tmao elisa kit

BlueGene Biotech P03T0008P-T2 Mouse Tumor Necrosis Factor α (TNF α) Protein, Recombinant

  • Immunology
  • Signal transduction
  • Epigenetics and Nuclear Signaling
  • Cancer

Tumor Necrosis Factor α (TNF α)  can also be called DIF; TNFA; TNFSF2; TNLG1F; TNF-alpha

Products

Specifications of P03T0008P-T2 Mouse Tumor Necrosis Factor α (TNF α) Protein, Recombinant

Product Information

catalog number

P03T0008P-T2

Package Size

10ug/50ug/500ug/1mg

Other Names

DIF; TNFA; TNFSF2; TNLG1F; TNF-alpha

Protein & NCBI Number

P06804, NM_013693.3

Host

E.coli

Express Region

Leu 80-Leu 235

Protein Sequence

LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQ
VLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLE
KGDQLSAEVNLPKYLDFAESGQVYFGVIAL

Molecular Weight

The protein molecule consists of 277 amino acids (including the fusion tag), with a predicted molecular
weight of 31.0 kDa and an actual molecular weight of 29-31 kDa

Fusion Tag

6xHis-SUMO (N-terminus)

Purity

≥90% SDS-PAGE

Physical Property

Liquid

Components

0.01M PBS+20% glycerol, sterile solution.

Storage & Stability

After aliquoting, the stability of the samples can be maintained for up to 6 months
at -20°C to -80°C, avoiding repeated freeze-thaw cycles.

Applications

Antibody preparation, immunoassay (ELISA, WB), subcellular localization and
interaction protein identification, etc.

Lead Time

5 to 10 business days;

2 to 3 days for stock products


Background

The TNF-α gene encodes a multifunctional pro-inflammatory cytokine that is a member of the tumor necrosis factor superfamily. It is primarily secreted by macrophages and exerts its functions by binding to tumor necrosis factor receptors. The tumor necrosis factor and tumor necrosis factor receptor superfamily proteins (TNFR SFP) are a group of ligand-receptor protein superfamilies. TNF contains a trimeric symmetric structural motif called the tumor necrosis factor homology domain (THD), which can bind to the cysteine-rich domains (CRDs) in TNF receptors (TNFRs). The diversity of CRDs leads to the heterogeneity of TNFRs.

The activity of TNF-α is mediated by its two receptors, TNF-R1 (p55) and TNF-R2 (p75), which have distinct signaling activities. TNF-R1 is generally pro-apoptotic, while TNF-R2 is usually anti-apoptotic. TNF-R1 and TNF-R2 have similar extracellular TNF-binding structures characterized by four repeated cysteine-rich domains, but they have different intracellular domains. The main structural differences between TNF-R1 and TNF-R2 lead to differences in their biological activities, primarily due to the lack of an intracellular death domain in TNF-R2.

TNF-α is pleiotropic and has been demonstrated to regulate a variety of inflammatory and autoimmune processes. Low levels of TNF-α can modulate the body’s immune response to act against infections, while high levels of TNF-α induce the secretion of other inflammatory factors such as IL-1, IL-6, IL-8, IL-10, IL-12, and promote inflammation within the body. TNF-α can kill tumors by promoting T cell proliferation and damaging vascular endothelial cells, as well as by recruiting immune cells, inducing the production of prostaglandins and cyclooxygenases, and inducing oxidative stress, thereby promoting cell degeneration and the progression of inflammation.


Related Products of Mouse Tumor Necrosis Factor α (TNF α) Protein, Recombinant

P01T0008P Human Tumor Necrosis Factor α (TNFα) Protein, Recombinant


BlueGene Biotech Product Show

Related Bluegene Biotech Products

Join us and become BlueGene's distributor, you will get a broad range of Life science research products and more than 12 years of experienced technical supports.