En
Email
  • tmao elisa kit
  • tmao elisa kit

BlueGene Biotech P01I0010P-T2 Human Interleukin 1β (IL-1β) Protein, Recombinant

  • Immunology
  • Cancer

Interleukin 1β (IL-1β) can also be called IL-1; IL1F2; IL1beta; IL1-BETA


Products

Specifications of P01I0010P-T2 Human Interleukin 1β (IL-1β) Protein, Recombinant

Product Information

catalog number

P01I0010P-T2

Package Size

10ug/50ug/500ug/1mg

Other Names

IL-1; IL1F2; IL1beta; IL1-BETA

Protein & NCBI Number

P01584, NM_000576.3

Host

E.coli

Express Region

Met1-Ser269

Protein Sequence

MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKML
VPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVV
FSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYI
STSQAENMPVFLGGTKGGQDITDFTMQFVSS

Molecular Weight

The protein molecule consists of 395 amino acids (including the fusion tag), with a predicted molecular
weight of 45.1 kDa, and an actual molecular weight of 47-50 kDa

Fusion Tag

6×His-SUMO (N-terminus)

Purity

≥60% SDS-PAGE

Physical Property

Liquid

Components

0.01M PBS+20% glycerol, sterile solution

Storage & Stability

After aliquoting, the stability of the samples can be maintained for up to 6 months
at -20°C to -80°C, avoiding repeated freeze-thaw cycles.

Applications

Antibody preparation, immunoassay (ELISA, WB), subcellular localization and
interaction protein identification, etc.

Lead Time

5 to 10 business days;

2 to 3 days for stock products



Background

Interleukin IL-1β also known as catabolin, is a member of the interleukin 1 cytokine family. IL1B, the cytokine encoded by the IL1B gene, is an inflammatory response and fever
mediator, and contributes to several lymphocyte activities including growth and differentiation of B-cells, proliferation of T-helper Type2 (Th2) clones, and activation of Th17 cells.
IL-1β is produced in peripheral blood mononuclear cells, tissue macrophages, and dendritic fine cells in response to immune responses, inflammation, infection, and trauma cells
such as cytium. IL1B is required for T-cell activation in some immune responses, and thus could contribute to increased T-cell replication. IL-1β can also act on distant target cells in an endocrine manner to induce systemic immune response. IL-1β can rapidly induce the expression of cytokines such as IL-6 and IL-8 of various cell types. At the same time, IL-1β
also induces its own expression, forming a positive feedback loop and amplifying the IL-1 response.


Related Products of Human Interleukin 1β (IL-1β) Protein, Recombinant

P01I0010P Human Interleukin 1β (IL1β) Protein, Recombinant

P01I0007P-T2 Human Interleukin 4 (IL4) Protein, Recombinant

P01I0006P-T2 Human Interleukin 6 (IL6) Protein, Recombinant

P01I0006P Human Interleukin 6 (IL6) Protein, Recombinant

P01I0056P-T2 Human Interleukin 8 (IL8) Protein, Recombinant

P01I0023P-T2 Human Interleukin 10 (IL10) Protein, Recombinant

P01I0308P-T2 Human Interleukin 2 (IL2) Protein, Recombinant

P01I0357P-T1 Human Interleukin 15 (IL15) Protein, Recombinant

P01I0310P-T1 Human Interleukin 18 (IL18) Protein, Recombinant

P01I0352P-T1 Human Interleukin 11 (IL11) Protein, Recombinant

P01I0383P-T2 Human Interleukin 3 (IL3) Protein, Recombinant

P03I0308P-T3 Mouse Interleukin 2 (IL2) Protein, Recombinant

P01I0308P Human Interleukin 2 (IL2) Protein, Recombinant

P03I0308P-T1 Mouse Interleukin 2 (IL2) Protein, Recombinant

P01I0383P Human Interleukin 3 (IL3) Protein, Recombinant


BlueGene Biotech Product Show

Related Bluegene Biotech Products

Join us and become BlueGene's distributor, you will get a broad range of Life science research products and more than 12 years of experienced technical supports.