Interleukin 1β (IL-1β) can also be called IL-1; IL1F2; IL1beta; IL1-BETA
Specifications of P01I0010P-T2 Human Interleukin 1β (IL-1β) Protein, Recombinant
| Product Information | |
catalog number | P01I0010P-T2 |
Package Size | 10ug/50ug/500ug/1mg |
Other Names | IL-1; IL1F2; IL1beta; IL1-BETA |
Protein & NCBI Number | P01584, NM_000576.3 |
Host | E.coli |
Express Region | Met1-Ser269 |
Protein Sequence | MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKML |
Molecular Weight | The protein molecule consists of 395 amino acids (including the fusion tag), with a predicted molecular |
Fusion Tag | 6×His-SUMO (N-terminus) |
Purity | ≥60% SDS-PAGE |
Physical Property | Liquid |
Components | 0.01M PBS+20% glycerol, sterile solution |
Storage & Stability | After aliquoting, the stability of the samples can be maintained for up to 6 months |
Applications | Antibody preparation, immunoassay (ELISA, WB), subcellular localization and |
Lead Time | 5 to 10 business days; 2 to 3 days for stock products |
Background |
Interleukin IL-1β also known as catabolin, is a member of the interleukin 1 cytokine family. IL1B, the cytokine encoded by the IL1B gene, is an inflammatory response and fever |
Related Products of Human Interleukin 1β (IL-1β) Protein, Recombinant
P01I0010P Human Interleukin 1β (IL1β) Protein, Recombinant
P01I0007P-T2 Human Interleukin 4 (IL4) Protein, Recombinant
P01I0006P-T2 Human Interleukin 6 (IL6) Protein, Recombinant
P01I0006P Human Interleukin 6 (IL6) Protein, Recombinant
P01I0056P-T2 Human Interleukin 8 (IL8) Protein, Recombinant
P01I0023P-T2 Human Interleukin 10 (IL10) Protein, Recombinant
P01I0308P-T2 Human Interleukin 2 (IL2) Protein, Recombinant
P01I0357P-T1 Human Interleukin 15 (IL15) Protein, Recombinant
P01I0310P-T1 Human Interleukin 18 (IL18) Protein, Recombinant
P01I0352P-T1 Human Interleukin 11 (IL11) Protein, Recombinant
P01I0383P-T2 Human Interleukin 3 (IL3) Protein, Recombinant
P03I0308P-T3 Mouse Interleukin 2 (IL2) Protein, Recombinant
P01I0308P Human Interleukin 2 (IL2) Protein, Recombinant
P03I0308P-T1 Mouse Interleukin 2 (IL2) Protein, Recombinant
P01I0383P Human Interleukin 3 (IL3) Protein, Recombinant