Interleukin 2 (IL2) can also be called IL-2; TCGF; lymphokine.
Specifications of P01I0308P Human Interleukin 2 (IL2) Protein, Recombinant
| Product Information | |
catalog number | P01I0308P |
Package Size | 10ug/50ug/500ug/1mg |
Other Names | IL-2; TCGF; lymphokine |
Protein & NCBI Number | P60568, NM_000586.4 |
Host | E.coli |
Express Region | Ala21-Thr153 |
Protein Sequence | APTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQCLEEELKPLEE |
Molecular Weight | The protein consists of 133 amino acids, with a predicted molecular weight of 15.4kDa, |
Fusion Tag | None |
Purity | ≥90% SDS-PAGE |
Physical Property | Liquid |
Components | 0.01M PBS+20% glycerol, sterile solution |
Storage & Stability | After aliquoting, the stability of the samples can be maintained for up to 6 |
Applications | Antibody preparation, immunoassay (ELISA, WB), subcellular localization and |
Lead Time | 5 to 10 business days; 2 to 3 days for stock products |
Background |
Interleukin-2 (IL-2) exerts both immunosuppressive and immunostimulatory effects on cytotoxic effector cells by activating regulatory T cells (Tregs). These IL-2-mediated effects Treg cells express high levels of IL-2Rα(CD25) along with intermediate levels of CD122 and γc. IL-2 was the first cytokine to be molecularly cloned and is an essential T cell growth factor, required for T cell proliferation, effector cell generation, and memory cell development. IL-2 supports the development, survival, and functional activity of Treg cells, thereby exerting dual and opposing roles: maintain Treg cells to suppress immune responses while activating conventional T cells to promote immune responses.. Studies have demonstrated that certain IL-2 conformations preferentially target Treg cells by increasing dependency on CD25 binding while reducing interaction with CD122. Recent therapeutic strategies have emerged that utilize IL-2, IL-2 monoclonal antibodies, or IL-2 variants to enhance the number and function of Treg cell for the treatment of autoimmune diseases, while simultaneously addressing the ongoing challenge of minimizing the activation of effector T cells, memory T cells, NK cells, and other innate lymphoid cell populations. |
Related Products of Human Interleukin 2 (IL2) Protein, Recombinant
P01I0010P Human Interleukin 1β (IL1β) Protein, Recombinant
P01I0010P-T2 Human Interleukin 1β (IL1β) Protein, Recombinant
P01I0007P-T2 Human Interleukin 4 (IL4) Protein, Recombinant
P01I0006P-T2 Human Interleukin 6 (IL6) Protein, Recombinant
P01I0006P Human Interleukin 6 (IL6) Protein, Recombinant
P01I0056P-T2 Human Interleukin 8 (IL8) Protein, Recombinant
P01I0023P-T2 Human Interleukin 10 (IL10) Protein, Recombinant
P01I0308P-T2 Human Interleukin 2 (IL2) Protein, Recombinant
P01I0357P-T1 Human Interleukin 15 (IL15) Protein, Recombinant
P01I0310P-T1 Human Interleukin 18 (IL18) Protein, Recombinant
P01I0352P-T1 Human Interleukin 11 (IL11) Protein, Recombinant
P01I0383P-T2 Human Interleukin 3 (IL3) Protein, Recombinant
P03I0308P-T3 Mouse Interleukin 2 (IL2) Protein, Recombinant
P01I0308P Human Interleukin 2 (IL2) Protein, Recombinant
P03I0308P-T1 Mouse Interleukin 2 (IL2) Protein, Recombinant