En
Email
  • tmao elisa kit
  • tmao elisa kit

BlueGene Biotech P01V0016E-T3 Human Vascular Endothelial Growth Factor 165 (VEGF165) Protein, Recombinant

  • Cancer
  • Cardiovascular
  • Signal Transduction
  • Metabolism

Vascular Endothelial Growth Factor 165 (VEGF165) can also be called VEGFA

Products

Specifications of P01V0016E-T3 Human Vascular Endothelial Growth Factor 165 (VEGF165) Protein, Recombinant

Product Information

catalog number

P01V0016E-T3

Package Size

10ug/50ug/500ug/1mg

Other Names

VEGFA

Protein & NCBI
Number

P15962-4, AAM03108.1

Host

293T

Express Region

Ala27-Arg191

Protein Sequence

MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLV
DIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSF
LQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERT

CRCDKPRR

Molecular Weight

The protein molecule consists of 198 amino acids (including the fusion tag), with a predicted molecular
weight of 23.3kDa and an actual molecular weight of 18-24kDa

Fusion Tag

6×His (C-terminus)

Purity

≥95% SDS-PAGE

Physical Property

Liquid

Components

0.01M PBS+20% glycerol, sterile solution.

Storage & Stability

After aliquoting, the stability of the samples can be maintained for up to 6 months at -20°C to -80°C,
avoiding repeated freeze-thaw cycles.

Applications

Antibody preparation, immunoassay (ELISA, WB), subcellular localization and interaction protein identification, etc.

Lead Time

5 to 10 business days;

2 to 3 days for stock products


Background

Vascular endothelial growth factor (VEGF or VEGF-A), also known as vascular permeability factor (VPF), is a potent mediator of angiogenesis and vasculogenesis in both fetal and adult tissues. It is a member of the PDGF family, characterized by the presence of 8 conserved cysteine residues and a cysteine knot structure. VEGF165 appears to be the most abundant and effective isoform, followed by VEGF121 and VEGF189. VEGF binds to the type I transmembrane receptor tyrosine kinases VEGF R1 (also known as Flt-1) and VEGF R2 (Flk-1/KDR) on endothelial cells. While VEGF shows highest affinity for VEGF R1, VEGF R2 seems to be the principal mediator of VEGF's angiogenic activity.

VEGF165 binds to the semaphorin receptor neuropilin-1 and promotes the formation of a complex with VEGF R2. VEGF is essential during embryogenesis, where it regulates the proliferation, migration, and survival of endothelial cells. In adults, VEGF primarily acts in wound healing and in the female reproductive cycle. Pathologically, it is involved in tumor angiogenesis and vascular leakage. Circulating VEGF levels are associated with disease activity in autoimmune diseases such as rheumatoid arthritis, multiple sclerosis, and systemic lupus erythematosus. VEGF is induced by hypoxia and cytokines such as IL-1, IL-6, IL-8, oncostatin M (OSM), and TNF-alpha.



Related Products of Human Vascular Endothelial Growth Factor 165 (VEGF165) Protein, Recombinant

P01F0003P Human Fibroblast Growth Factor 2 (FGF2) Protein, Recombinant

P01F0003P-T2 Human Fibroblast Growth Factor 2 (FGF2) Protein, Recombinant

P01I0420P-T2 Human Insulin-like Growth Factor 1 Long R3 Analog (IGF1-LR3) Protein, Recombinant

P01E0032P Human Epidermal Growth Factor (EGF) Protein, Recombinant

P01F0073P-T2 Human Fibroblast Growth Factor 9 (FGF9) Protein, Recombinant

P01I0420P Human Insulin-like Growth Factor 1 Long R3 Analog (IGF1-LR3) Protein, Recombinant

P01E0032P-T2 Human Epidermal Growth Factor (EGF) Protein, Recombinant

P01F0221P-T2 Human Fibroblast Growth Factor 10 (FGF10) Protein, Recombinant


BlueGene Biotech Product Show

Related Bluegene Biotech Products

Join us and become BlueGene's distributor, you will get a broad range of Life science research products and more than 12 years of experienced technical supports.