En
Email
  • tmao elisa kit
  • tmao elisa kit

BlueGene Biotech P03I0308P-T1 Mouse Interleukin 2 (IL2) Protein, Recombinant

  • Immunology
  • Neuroscience
  • Cancer
  • Metabolism

Interleukin 2 (IL2) can also be called IL-2; TCGF; lymphokine.

Products

Specifications of P03I0308P-T1 Mouse Interleukin 2 (IL2) Protein, Recombinant

Product Information

catalog number

P03I0308P-T1

Package Size

10ug/50ug/500ug/1mg

Other Names

IL-2; TCGF; lymphokine

Protein & NCBI Number

P04351

Host

E.coli

Express Region

Met1-Gln169

Protein Sequence

MYSMQLASCVTLTLVLLVNSAPTSSSTSSSTAEAQQQQQQQQQQQQHLEQLLMDLQ
ELLSRMENYRNLKLPRMLTFKFYLPKQATELKDLQCLEDELGPLRHVLDLTQSKSFQLE
DAENFISNIRVTVVKLKGSDNTFECQFDDESATVVDFLRRWIAFCQSIISTSPQ

Molecular Weight

The protein consists of 303 amino acids (including the fusion tag), with a predicted molecular
weight of 34.4kDa, which matches the actual molecular weight

Fusion Tag

SUMO(N-terminus), (6×His (C-terminus)

Purity

≥60% SDS-PAGE

Physical Property

Liquid

Components

0.01M PBS+20% glycerol, sterile solution

Storage & Stability

After aliquoting, the stability of the samples can be maintained for up to 6 months at -20°C to -80°C,
avoiding repeated freeze-thaw cycles

Applications

Applications Antibody preparation, immunoassay (ELISA, WB), subcellular localization
and interaction protein identification, etc

Lead Time

5 to 10 business days;

2 to 3 days for stock products








Background

Interleukin-2 (IL-2) exerts both immunosuppressive and immunostimulatory effects on cytotoxic effector cells by activating regulatory T cells (Tregs). These IL-2-mediated effects depend on distinct expression patterns of IL-2 receptors (IL-2R): CD8+T cells and natural killer (NK) cells express high levels of the dimeric IL-2Rβ(CD122) and IL-2Rγ(γc) chains, while Treg cells express high levels of IL-2Rα(CD25) along with intermediate levels of CD122 and γc.

IL-2 was the first cytokine to be molecularly cloned and is an essential T cell growth factor, required for T cell proliferation, effector cell generation, and memory cell development. IL-2 supports the development, survival, and functional activity of Treg cells, thereby exerting dual and opposing roles: maintain Treg cells to suppress immune responses while activating conventional T cells to promote immune responses..

Studies have demonstrated that certain IL-2 conformations preferentially target Treg cells by increasing dependency on CD25 binding while reducing interaction with CD122. Recent therapeutic strategies have emerged that utilize IL-2, IL-2 monoclonal antibodies, or IL-2 variants to enhance the number and function of Treg cell for the treatment of autoimmune diseases, while simultaneously addressing the ongoing challenge of minimizing the activation of effector T cells, memory T cells, NK cells, and other innate lymphoid cell populations.


Related Products of Mouse Interleukin 2 (IL2) Protein, Recombinant

P01I0010P Human Interleukin 1β (IL1β) Protein, Recombinant

P01I0010P-T2 Human Interleukin 1β (IL1β) Protein, Recombinant

P01I0007P-T2 Human Interleukin 4 (IL4) Protein, Recombinant

P01I0006P-T2 Human Interleukin 6 (IL6) Protein, Recombinant

P01I0006P Human Interleukin 6 (IL6) Protein, Recombinant

P01I0056P-T2 Human Interleukin 8 (IL8) Protein, Recombinant

P01I0023P-T2 Human Interleukin 10 (IL10) Protein, Recombinant

P01I0308P-T2 Human Interleukin 2 (IL2) Protein, Recombinant

P01I0357P-T1 Human Interleukin 15 (IL15) Protein, Recombinant

P01I0310P-T1 Human Interleukin 18 (IL18) Protein, Recombinant

P01I0352P-T1 Human Interleukin 11 (IL11) Protein, Recombinant

P01I0383P-T2 Human Interleukin 3 (IL3) Protein, Recombinant

P03I0308P-T3 Mouse Interleukin 2 (IL2) Protein, Recombinant

P01I0308P Human Interleukin 2 (IL2) Protein, Recombinant

P01I0383P Human Interleukin 3 (IL3) Protein, Recombinant



BlueGene Biotech Product Show

Related Bluegene Biotech Products

Join us and become BlueGene's distributor, you will get a broad range of Life science research products and more than 12 years of experienced technical supports.