En
Email
  • tmao-elisa-kit
  • tmao-elisa-kit

BlueGene Biotech P01I0006P Human Interleukin-6 (IL-6) Protein, Recombinant

  • Immunology
  • Cardiovascular

Interleukin-6 (IL-6) can also be called CDF; HGF; HSF; BSF2; IL-6; BSF-2; IFNB2; IFN-beta-2

Products

Specifications Of P01I0006P Human Interleukin-6 (IL-6) Protein, Recombinant

Product Information

catalog number

P01I0006P

Package Size

10ug/50ug/500ug/1mg

Other Names

CDF; HGF; HSF; BSF2; IL-6; BSF-2; IFNB2; IFN-beta-2

Protein & NCBI Number

P05231, NM_000600.5

Host

E.coli

Express Region

Met1-Met212

Protein Sequence

MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERI
DKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQS
GFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQ
KKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Molecular Weight

The protein consists of 217 amino acids, with a predicted molecular weight of 24.3kDa,
which matches the actual molecular weight.

Fusion Tag

None

Purity

≥90% SDS-PAGE

Physical Property

Liquid

Components

0.01M PBS+20% glycerol, sterile solution

Storage & Stability

After aliquoting, the stability of the samples can be maintained for up to 6
months at -20°C to -80°C, avoiding repeated freeze-thaw cycles

Applications

Antibody preparation, immunoassay (ELISA, WB), subcellular localization and interaction protein
identification, etc

Lead Time

5 to 10 business days;

2 to 3 days for stock products


Background

IL-6 gene encodes a cytokine that functions in inflammation and the maturation of B cells. In addition, the encoded protein has been shown to be an endogenous pyrogen capable of inducing fever in people with autoimmune diseases or infections. The protein is primarily produced at sites of acute and chronic
inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of
this gene is implicated in a wide variety of inflammation-associated disease states, including susceptibility to diabetes mellitus and systemic juvenile rheumatoid arthritis. Elevated levels of the encoded protein have been found in virus infections, including COVID-19 (disease caused by SARS-CoV-2)


Related Products Of Human Interleukin-6 (IL-6) Protein, Recombinant

P01I0010P Human Interleukin 1β (IL1β) Protein, Recombinant

P01I0010P-T2 Human Interleukin 1β (IL1β) Protein, Recombinant

P01I0007P-T2 Human Interleukin 4 (IL4) Protein, Recombinant

P01I0006P-T2 Human Interleukin 6 (IL6) Protein, Recombinant

P01I0056P-T2 Human Interleukin 8 (IL8) Protein, Recombinant

P01I0023P-T2 Human Interleukin 10 (IL10) Protein, Recombinant

P01I0308P-T2 Human Interleukin 2 (IL2) Protein, Recombinant

P01I0357P-T1 Human Interleukin 15 (IL15) Protein, Recombinant

P01I0310P-T1 Human Interleukin 18 (IL18) Protein, Recombinant

P01I0352P-T1 Human Interleukin 11 (IL11) Protein, Recombinant

P01I0383P-T2 Human Interleukin 3 (IL3) Protein, Recombinant

P03I0308P-T3 Mouse Interleukin 2 (IL2) Protein, Recombinant

P01I0308P Human Interleukin 2 (IL2) Protein, Recombinant

P03I0308P-T1 Mouse Interleukin 2 (IL2) Protein, Recombinant

P01I0383P Human Interleukin 3 (IL3) Protein, Recombinant



BlueGene Biotech Product Show

Related Bluegene Biotech Products

Join us and become BlueGene's distributor, you will get a broad range of Life science research products and more than 12 years of experienced technical supports.