Name: P01I0023P-T2 Human Interleukin 10 (IL-10) Protein, Recombinant
Brand: Shanghai BlueGene Biotech CO., LTD.
Price: 100 USD

BlueGene Biotech P01I0023P-T2 Human Interleukin 10 (IL-10) Protein, Recombinant

Immunology

Neuroscience

Cancer

Metabolism

Interleukin 10 (IL-10) can also be called CSIF; TGIF; GVHDS; IL-10; IL10A

Products

Specifications of P01I0023P-T2 Human Interleukin 10 (IL-10) Protein, Recombinant

Product Information
catalog number	P01I0023P-T2
Package Size	10ug/50ug/500ug/1mg
Other Names	CSIF; TGIF; GVHDS; IL-10; IL10A
Protein & NCBI Number	P22301, NM_000572.3
Host	E.coli
Express Region	Met1-Asn178
Protein Sequence	MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLE DFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAF NKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Molecular Weight	The protein consists of 304 amino acids (including the fusion tag), with a predicted molecular weight of 34.8kDa, which matches the actual molecular weight.
Fusion Tag	6×His-SUMO (N-terminus)
Purity	≥75% Non-reducing SDS-PAGE
Physical Property	Liquid
Components	0.01M PBS+20% glycerol, sterile solution
Storage & Stability	After aliquoting, the stability of the samples can be maintained for up to 6 months at -20°C to -80°C, avoiding repeated freeze-thaw cycles.
Applications	Antibody preparation, immunoassay (ELISA, WB), subcellular localization and interaction protein identification, etc.
Lead Time	5 to 10 business days; 2 to 3 days for stock products

Background

IL-10 is composed of 178 amino acids, produced by B cells, Th1, Th2 and other adaptive immune cells.IL-10 activates a wide range of macrophage/monocyte functions,
including the synthesis of monocyte factors, NO production, and the expression of major histocompatibility complex classⅡ (MHCⅡ) costimulatory molecules such as
IL-12 and CD80/CD86. The inhibitory effect of IL-10 on IL-1 and TNF is key to its anti-inflammatory activity, as these two cytokines often have synergistic

effects on inflammatory pathways and processes, expanding the inflammatory response through secondary mediators such as chemokines, PGs, and PAF.
Regulating the inflammatory response in the context of constant stress is important for a living organism.

IL-10 is a multifunctional cytokine that regulates the function of hematopoietic cells.