Interleukin 8 (IL 8) can also be called as IL8, NAF, GCP1, LECT, LUCT, NAP1, GCP-1, LYNAP, MDNCF, MONAP, NAP-1, SCYB8.
Specifications Of P01I0031 Human IL 8 Protein, Recombinant
Porduct's Information | |
CatalogNumber | P01I0031 |
Package Size | 10ug/50ug/100ug/1mg |
Other Names | IL8; NAF; GCP1; LECT; LUCT; NAP1; GCP-1; LYNAP; MDNCF; MONAP; NAP-1; SCYB8 |
Protein & NCBI Number | P10145, NM_000584.4 |
Host | E.coli |
Express Region | 1-99aa |
Protein Length | Total length of the protein(including Tag) |
Protein Sequence | MTSKLAVALLAAFLISAALCEGAVLPRSAKELRCQCIKTYSKPF HPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS |
Molecular Weight | about 11.1kDa |
Fusion Tag | 6×His-SUMO (N-terminus) |
Purity | ≥95% SDS-PAGE |
Physical Property | liquid or lyophilized powder |
Reconstitution | Storage solution: We recommend using PBS or a suitable solvent according to the experimental requirements to prepare 1mg/mL storage solution, aliquot and store at -20 °C. Working solution: According to the experimental requirement, dilute Storage solution. The working solution can be stored at 4°C for 2-3 weeks after dilution. |
Storage & Stability | The shelf life of liquid form is 6 months stored at -20 °C /-80 °C. The shelf life of lyophilized form is 12 months stored at -20 °C /-80 °C. |
Applications | Antibody preparation, immunoassay (ELISA, WB), subcellular localization and interaction protein identification, etc. |
Lead Time | 5 to 10 business days; 2 to 3 days for stock products |
Background |
The protein encoded by IL8 gene is a member of the CXC chemokine family and is a major mediator of inflammatory responses. The IL-8 protein is secreted by mononuclear macrophages, neutrophils, eosinophils, T lymphocytes, epithelial cells, and fibroblasts. It functions as a chemotactic factor by guiding the neutrophils to the site of infection. Bacterial and viral products rapidly induce IL-8 expression. IL-8 also participates with other cytokines in the proinflammatory signaling cascade and plays a role in systemic inflammatory response syndrome (SIRS). This gene is believed to play a role in the pathogenesis of the lower respiratory tract infection bronchiolitis (a common respiratory tract disease caused by the respiratory syncytial virus (RSV), the lung inflammation associated with csytic fibrosis, coronary artery disease and endothelial dysfunction. IL-8 is also secreted by tumor cells and promotes tumor migration, invasion, angiogenesis and metastasis. This chemokine is also a potent angiogenic factor. The binding of IL-8 to one of its receptors (IL-8RB/CXCR2) increases the permeability of blood vessels and increasing levels of IL-8 are positively correlated with increased severity of multiple disease outcomes. This gene and other members of the CXC chemokine gene family form a gene cluster in a region of chromosome 4q. |
BlueGene Biotech Product Show
Related Products Of Human Interleukin 8 (IL 8) Protein, Recombinant
P01I0069 Human Interleukin 4 (IL 4) Protein, Recombinant
P01I0070 Human Interleukin 6 (IL 6) Protein, Recombinant