Name: P01I0031 Human Interleukin 8 (IL 8) Protein, Recombinant
Brand: Shanghai BlueGene Biotech CO., LTD.

P01I0031 Human Interleukin 8 (IL 8) Protein, Recombinant

Interleukin 8 (IL 8) can also be called as IL8, NAF, GCP1, LECT, LUCT, NAP1, GCP-1, LYNAP, MDNCF, MONAP, NAP-1, SCYB8.

Specifications Of P01I0031 Human IL 8 Protein, Recombinant

Porduct's Information
CatalogNumber	P01I0031
Package Size	10ug/50ug/100ug/1mg
Other Names	IL8; NAF; GCP1; LECT; LUCT; NAP1; GCP-1; LYNAP; MDNCF; MONAP; NAP-1; SCYB8
Protein & NCBI Number	P10145, NM_000584.4
Host	E.coli
Express Region	1-99aa
Protein Length	Total length of the protein（including Tag）
Protein Sequence	MTSKLAVALLAAFLISAALCEGAVLPRSAKELRCQCIKTYSKPF HPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Molecular Weight	about 11.1kDa
Fusion Tag	6×His-SUMO (N-terminus)
Purity	≥95% SDS-PAGE
Physical Property	liquid or lyophilized powder
Reconstitution	Storage solution: We recommend using PBS or a suitable solvent according to the experimental requirements to prepare 1mg/mL storage solution, aliquot and store at -20 °C. Working solution: According to the experimental requirement, dilute Storage solution. The working solution can be stored at 4°C for 2-3 weeks after dilution.
Storage & Stability	The shelf life of liquid form is 6 months stored at -20 °C /-80 °C. The shelf life of lyophilized form is 12 months stored at -20 °C /-80 °C.
Applications	Antibody preparation, immunoassay (ELISA, WB), subcellular localization and interaction protein identification, etc.
Lead Time	5 to 10 business days; 2 to 3 days for stock products

Background

The protein encoded by IL8 gene is a member of the CXC chemokine family and is a major mediator of inflammatory responses. The IL-8 protein is secreted by mononuclear macrophages, neutrophils, eosinophils, T lymphocytes, epithelial cells, and fibroblasts. It functions as a chemotactic factor by guiding the neutrophils to the site of infection. Bacterial and viral products rapidly induce IL-8 expression. IL-8 also participates with other cytokines in the proinflammatory signaling cascade and plays a role in systemic inflammatory response syndrome (SIRS). This gene is believed to play a role in the pathogenesis of the lower respiratory tract infection bronchiolitis (a common respiratory tract disease caused by the respiratory syncytial virus (RSV), the lung inflammation associated with csytic fibrosis, coronary artery disease and endothelial dysfunction.

IL-8 is also secreted by tumor cells and promotes tumor migration, invasion, angiogenesis and metastasis. This chemokine is also a potent angiogenic factor. The binding of IL-8 to one of its receptors (IL-8RB/CXCR2) increases the permeability of blood vessels and increasing levels of IL-8 are positively correlated with increased severity of multiple disease outcomes. This gene and other members of the CXC chemokine gene family form a gene cluster in a region of chromosome 4q.