Name: P01I0352P-T1 Human Interleukin 11 (IL-11) Protein, Recombinant
Brand: Shanghai BlueGene Biotech CO., LTD.
Price: 100 USD

BlueGene Biotech P01I0352P-T1 Human Interleukin 11 (IL-11) Protein, Recombinant

Immunology

Cardiovascular

Interleukin 11 (IL-11) can also be called AGIF; IL-11.

Products

Specifications of P01I0352P-T1 Human Interleukin 11 (IL-11) Protein, Recombinant

Product Information
catalog number	P01I0352P-T1
Package Size	10ug/50ug/500ug/1mg
Other Names	AGIF; IL-11
Protein & NCBI Number	M57765, P20809
Host	E.coli
Express Region	Pro22-Leu199
Protein Sequence	MGSSHMASMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQAD QTPEDLDMEDNDIIEAHREQIGGPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMS AGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPS SAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRLKHHHHHH
Molecular Weight	The protein molecule consists of 291 amino acids (including the fusion tag), with a predicted molecular weight of 32.13kDa and an actual molecular weight of 35kDa
Fusion Tag	SUMO (N-terminus), 6×His (C-terminus)
Purity	≥95% SDS-PAGE
Physical Property	Liquid
Components	0.01M PBS+20% glycerol, sterile solution
Storage & Stability	After aliquoting, the stability of the samples can be maintained for up to 6 months at -20°C to -80°C, avoiding repeated freeze-thaw cycles
Applications	Antibody preparation, immunoassay (ELISA, WB), subcellular localization and interaction protein identification, etc
Lead Time	5 to 10 business days; 2 to 3 days for stock products

Background

Interleukin-11 (IL-11) is a growth factor that stimulates the proliferation and differentiation of hematopoietic stem cells, leading to the production of multiple blood cell lineages, including erythrocytes, granulocytes, and platelets. IL-11 is pro-inflammatory and can induce the production of other cytokines (such as IL-6, IL-8, and GM-CSF), which recruit immune cells to the site of inflammation. IL-11 enhances the activity of immune cells (including T cells, B cells, and macrophages) and promotes the production of antibodies.

IL-11 inhibits the activity of osteoclasts, which are responsible for bone resorption, and promotes the differentiation of osteoblasts, which are responsible for bone formation. IL-11 facilitates the differentiation of pre-adipocytes into mature adipocytes, which may contribute to obesity and insulin resistance. IL-11 has been implicated in the progression of various cancers, including multiple myeloma, Hodgkin's lymphoma, and breast cancer, by promoting the growth, survival, and angiogenesis of tumor cells. IL-11 may also promote the development of fibrotic diseases, such as pulmonary fibrosis and liver fibrosis, by enhancing the activation of fibroblasts and the deposition of extracellular matrix.

IL-11 has shown neuroprotective effects in certain contexts, including ischemic stroke and neurodegenerative diseases, by diminishing inflammation and enhancing neuronal survival.

IL-11 is involved in the regulation of reproductive processes, including implantation, placental formation, and parturition.