En
Email
  • tmao elisa kit
  • tmao elisa kit

BlueGene Biotech P01I0352P-T1 Human Interleukin 11 (IL-11) Protein, Recombinant

  • Immunology
  • Cardiovascular

Interleukin 11 (IL-11) can also be called AGIF; IL-11.

Products

Specifications of P01I0352P-T1 Human Interleukin 11 (IL-11) Protein, Recombinant

Product Information

catalog number

P01I0352P-T1

Package Size

10ug/50ug/500ug/1mg

Other Names

AGIF; IL-11

Protein & NCBI Number

M57765, P20809

Host

E.coli

Express Region

Pro22-Leu199

Protein Sequence

MGSSHMASMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQAD
QTPEDLDMEDNDIIEAHREQIGGPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMS
AGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPS
SAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRLKHHHHHH

Molecular Weight

The protein molecule consists of 291 amino acids (including the fusion tag), with a predicted molecular weight of 32.13kDa and an actual molecular weight of 35kDa

Fusion Tag

SUMO (N-terminus), 6×His (C-terminus)

Purity

≥95% SDS-PAGE

Physical Property

Liquid

Components

0.01M PBS+20% glycerol, sterile solution

Storage & Stability

After aliquoting, the stability of the samples can be maintained for up to 6
months at -20°C to -80°C, avoiding repeated freeze-thaw cycles

Applications

Antibody preparation, immunoassay (ELISA, WB), subcellular localization and
interaction protein identification, etc

Lead Time

5 to 10 business days;

2 to 3 days for stock products


Background

Interleukin-11 (IL-11) is a growth factor that stimulates the proliferation and differentiation of hematopoietic stem cells, leading to the production of multiple blood cell lineages, including erythrocytes, granulocytes, and platelets. IL-11 is pro-inflammatory and can induce the production of other cytokines (such as IL-6, IL-8, and GM-CSF), which recruit immune cells to the site of inflammation. IL-11 enhances the activity of immune cells (including T cells, B cells, and macrophages) and promotes the production of antibodies.

IL-11 inhibits the activity of osteoclasts, which are responsible for bone resorption, and promotes the differentiation of osteoblasts, which are responsible for bone formation. IL-11 facilitates the differentiation of pre-adipocytes into mature adipocytes, which may contribute to obesity and insulin resistance. IL-11 has been implicated in the progression of various cancers, including multiple myeloma, Hodgkin's lymphoma, and breast cancer, by promoting the growth, survival, and angiogenesis of tumor cells. IL-11 may also promote the development of fibrotic diseases, such as pulmonary fibrosis and liver fibrosis, by enhancing the activation of fibroblasts and the deposition of extracellular matrix.

IL-11 has shown neuroprotective effects in certain contexts, including ischemic stroke and neurodegenerative diseases, by diminishing inflammation and enhancing neuronal survival.

IL-11 is involved in the regulation of reproductive processes, including implantation, placental formation, and parturition.


Related Products of Human Interleukin 11 (IL-11) Protein, Recombinant

P01I0010P Human Interleukin 1β (IL1β) Protein, Recombinant

P01I0010P-T2 Human Interleukin 1β (IL1β) Protein, Recombinant

P01I0007P-T2 Human Interleukin 4 (IL4) Protein, Recombinant

P01I0006P-T2 Human Interleukin 6 (IL6) Protein, Recombinant

P01I0006P Human Interleukin 6 (IL6) Protein, Recombinant

P01I0056P-T2 Human Interleukin 8 (IL8) Protein, Recombinant

P01I0023P-T2 Human Interleukin 10 (IL10) Protein, Recombinant

P01I0308P-T2 Human Interleukin 2 (IL2) Protein, Recombinant

P01I0357P-T1 Human Interleukin 15 (IL15) Protein, Recombinant

P01I0310P-T1 Human Interleukin 18 (IL18) Protein, Recombinant

P01I0383P-T2 Human Interleukin 3 (IL3) Protein, Recombinant

P03I0308P-T3 Mouse Interleukin 2 (IL2) Protein, Recombinant

P01I0308P Human Interleukin 2 (IL2) Protein, Recombinant

P03I0308P-T1 Mouse Interleukin 2 (IL2) Protein, Recombinant



BlueGene Biotech Product Show

Related Bluegene Biotech Products

Join us and become BlueGene's distributor, you will get a broad range of Life science research products and more than 12 years of experienced technical supports.