Transforming Growth Factor β2 (TGFB2) can also be called as LDS4, G-TSF, TGF-beta2.
Specifications Of P01T0004 Human TGFB2 Protein, Recombinant
Porduct's Information | |
CatalogNumber | P01T0004 |
Package Size | 10ug/50ug/100ug/1mg |
Other Names | LDS4; G-TSF; TGF-beta2 |
Protein & NCBI Number | P61812, NM_001135599.4 |
Host | E.coli |
Express Region | 1-442aa |
Protein Length | Total length of the protein(including Tag) |
Protein Sequence | MHYCVLSAFLILHLVTVALSLSTCSTLDMDQFMRKRIEAIRGQI LSKLKLTSPPEDYPEPEEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKE VYKIDMPPFFPSETVCPVVTTPSGSVGSLCSRQSQVLCGYLDAIPPTFYRPYFRIVRF DVSAMEKNASNLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVV KTRAEGEWLSFDVTDAVHEWLHHKDRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEA RFAGIDGTSTYTSGDQKTIKSTRKKNSGKTPHLLLMLLPSYRLESQQTNRRKKRALDA AYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVL SLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS |
Molecular Weight | about 50.6kDa |
Fusion Tag | 6×His-SUMO (N-terminus) |
Purity | ≥95% SDS-PAGE |
PhysicalProperty | liquid or lyophilized powder |
Reconstitution | Storage solution: We recommend using PBS or a suitable solvent according to the experimental requirements to prepare 1mg/mL storage solution, aliquot and store at -20 °C. Working solution: According to the experimental requirement, dilute Storage solution. The working solution can be stored at 4°C for 2-3 weeks after dilution. |
Storage & Stability | The shelf life of liquid form is 6 months stored at -20 °C /-80 °C. The shelf life of lyophilized form is 12 months stored at -20 °C /-80 °C. |
Applications | Antibody preparation, immunoassay (ELISA, WB), subcellular localization and interaction protein identification, etc. |
Lead Time | 5 to 10 business days; 2 to 3 days for stock products |
Background |
TGFβ2 is a multifunctional polypeptide cytokine composed of 442 amino acids. It plays an important role in cell morphology, proliferation, differentiation, embryonic development and angiogenesis, and plays a very key role in the regulation of human immune system. The activated receptor complex signal is transmitted to cells mainly through Smad protein family. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate a latency-associated peptide (LAP) and a mature peptide, and is found in either a latent form composed of a mature peptide homodimer, a LAP homodimer, and a latent TGF-beta binding protein, or in an active form consisting solely of the mature peptide homodimer. The mature peptide may also form heterodimers with other TGF-beta family members. Disruption of the TGF-beta/SMAD pathway has been implicated in a variety of human cancers. TGFβ2 is also an important immunosuppressive factor. By inhibiting the activation and proliferation of T cells and B cells, TGF- β 2 can affect the activity of natural killer cells and reduce IL-2, IL-6, IL-10 and IFN- γ And other cytokines. |
Related Products Of Human Transforming Growth Factor β2 (TGFB2) Protein, Recombinant
P01F0002 Human Fibroblast Growth Factor 2 (FGF2) Protein, Recombinant
P01F0008 Human Fibroblast Growth Factor 17(FGF17) Protein, Recombinant
P01T0005 Human Transforming Growth Factor β3 (TGFB3) Protein, Recombinant