Name: P01I0053 Human Interleukin 1β (IL 1β) Protein, Recombinant
Brand: Shanghai BlueGene Biotech CO., LTD.

P01I0053 Human Interleukin 1β (IL 1β) Protein, Recombinant

Interleukin 1β (IL 1β) can also be called as IL-1, IL1F2, IL1beta, IL1-BETA.

Specifications Of P01I0053 Human IL 1β Protein, Recombinant

Porduct's Information Porduct's Information
CatalogNumber	P01I0053
Package Size	10ug/50ug/100ug/1mg
Other Names	IL-1; IL1F2; IL1beta; IL1-BETA
Protein & NCBI Number	P01584, NM_000576.3
Host	E.coli
Express Region	1-269aa
Protein Length	Total length of the protein（including Tag）
Protein Sequence	MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Molecular Weight	about30.7kDa
Fusion Tag	6×His-SUMO (N-terminus)
Purity	≥95% SDS-PAGE
PhysicalProperty	liquid or lyophilized powder
Reconstitution	Storage solution: We recommend using PBS or a suitable solvent according to the experimental requirements to prepare 1mg/mL storage solution, aliquot and store at -20 °C. Working solution: According to the experimental requirement, dilute Storage solution. The working solution can be stored at 4°C for 2-3 weeks after dilution.
Storage & Stability	The shelf life of liquid form is 6 months stored at -20 °C /-80 °C. The shelf life of lyophilized form is 12 months stored at -20 °C /-80 °C.
Applications	Antibody preparation, immunoassay (ELISA, WB), subcellular localization and interaction protein identification, etc.
Lead Time	5 to 10 business days; 2 to 3 days for stock products

Background

Interleukin IL-1β also known as catabolin, is a member of the interleukin 1 cytokine family. IL1B, the cytokine encoded by the IL1B gene, is an inflammatory response and fever mediator, and contributes to several lymphocyte activities including growth and differentiation of B-cells, proliferation of T-helper Type2 (Th2) clones, and activation of Th17 cells. IL-1β is produced in peripheral blood mononuclear cells, tissue macrophages, and dendritic fine cells in response to immune responses, inflammation, infection, and trauma cells such as cytium. IL1B is required for T-cell activation in some immune responses, and thus could contribute to increased T-cell replication. IL-1β can also act on distant target cells in an endocrine manner to induce systemic immune response. IL-1β can rapidly induce the expression of cytokines such as IL-6 and IL-8 of various cell types. At the same time, IL-1β also induces its own expression, forming a positive feedback loop and amplifying the IL-1 response.