Interleukin 10 (IL 10) can also be called as CSIF, TGIF, GVHDS, IL-10, IL10A.
Specifications Of P01P0054 Human IL 10 Protein, Recombinant
Porduct's Information | |
CatalogNumber | P01P0054 |
Package Size | 10ug/50ug/100ug/1mg |
Other Names | CSIF; TGIF; GVHDS; IL-10; IL10A |
Protein & NCBI Number | P22301, NM_000572.3 |
Host | E.coli |
Express Region | 1-178aa |
Protein Length | Total length of the protein(including Tag) |
Protein Sequence | MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDL RDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQD PDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSE FDIFINYIEAYMTMKIRN |
Molecular Weight | about 20.5kDa |
Fusion Tag | 6×His-SUMO (N-terminus) |
Purity | ≥95% SDS-PAGE |
PhysicalProperty | liquid or lyophilized powder |
Reconstitution | Storage solution: We recommend using PBS or a suitable solvent according to the experimental requirements to prepare 1mg/mL storage solution, aliquot and store at -20 °C. Working solution: According to the experimental requirement, dilute Storage solution. The working solution can be stored at 4°C for 2-3 weeks after dilution. |
Storage & Stability | The shelf life of liquid form is 6 months stored at -20 °C /-80 °C. The shelf life of lyophilized form is 12 months stored at -20 °C /-80 °C. |
Applications | Antibody preparation, immunoassay (ELISA, WB), subcellular localization and interaction protein identification, etc. |
Lead Time | 5 to 10 business days; 2 to 3 days for stock products |
Background |
IL-10 is composed of 178 amino acids, produced by B cells, Th1, Th2 and other adaptive immune cells.IL-10 activates a wide range of macrophage/monocyte functions, including the synthesis of monocyte factors, NO production, and the expression of major histocompatibility complex classⅡ (MHCⅡ) costimulatory molecules such as IL-12 and CD80/CD86. The inhibitory effect of IL-10 on IL-1 and TNF is key to its anti-inflammatory activity, as these two cytokines often have synergistic effects on inflammatory pathways and processes, expanding the inflammatory response through secondary mediators such as chemokines, PGs, and PAF. Regulating the inflammatory response in the context of constant stress is important for a living organism. IL-10 is a multifunctional cytokine that regulates the function of hematopoietic cells. |
BlueGene Biotech Product Show
Related Products Of Human Interleukin 10 (IL 10) Protein, Recombinant
P01I0069 Human Interleukin 4 (IL 4) Protein, Recombinant
P01I0070 Human Interleukin 6 (IL 6) Protein, Recombinant
P01I0031 Human Interleukin 8 (IL 8) Protein, Recombinant
P01I0053 Human Interleukin 1β (IL 1β) Protein, Recombinant