Interleukin 6 (IL 6) can also be called as CDF, HGF, HSF, BSF2, IL-6, BSF-2, IFNB2, IFN-beta-2.
Specifications Of P01I0070 Human IL 6 Protein, Recombinant
Porduct's Information | |
CatalogNumber | P01I0070 |
Package Size | 10ug/50ug/100ug/1mg |
Other Names | CDF; HGF; HSF; BSF2; IL-6; BSF-2; IFNB2; IFN-beta-2 |
Protein & NCBI Number | P05231, NM_000600.5 |
Host | E.coli |
Express Region | 1-212aa |
Protein Length | Total length of the protein(including Tag) |
Protein Sequence | MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHR QPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCF QSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKN LDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |
Molecular Weight | about 23.7kDa |
Fusion Tag | 6×His-SUMO (N-terminus) |
Purity | ≥95% SDS-PAGE |
PhysicalProperty | liquid or lyophilized powder |
Reconstitution | Storage solution: We recommend using PBS or a suitable solvent according to the experimental requirements to prepare 1mg/mL storage solution, aliquot and store at -20 °C. Working solution: According to the experimental requirement, dilute Storage solution. The working solution can be stored at 4°C for 2-3 weeks after dilution. |
Storage & Stability | The shelf life of liquid form is 6 months stored at -20 °C /-80 °C. The shelf life of lyophilized form is 12 months stored at -20 °C /-80 °C. |
Applications | Antibody preparation, immunoassay (ELISA, WB), subcellular localization and interaction protein identification, etc. |
Lead Time | 5 to 10 business days; 2 to 3 days for stock products |
Background |
IL-6 gene encodes a cytokine that functions in inflammation and the maturation of B cells. In addition, the encoded protein has been shown to be an endogenous pyrogen capable of inducing fever in people with autoimmune diseases or infections. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including susceptibility to diabetes mellitus and systemic juvenile rheumatoid arthritis. Elevated levels of the encoded protein have been found in virus infections, including COVID-19 (disease caused by SARS-CoV-2). |
BlueGene Biotech Product Show
Related Products Of Human Interleukin 6 (IL 6) Protein, Recombinant
P01I0069 Human Interleukin 4 (IL 4) Protein, Recombinant
P01I0031 Human Interleukin 8 (IL 8) Protein, Recombinant