Bone Morphogenetic Protein Receptortype 1B (BMPR1B) can also be called as ALK-6, ALK6, AMD3, AMDD, BDA1D, BDA2, CDw293.
Specifications Of P01B0012 Human BMPR1B Protein, Recombinant
Porduct's Information | |
CatalogNumber | P01B0012 |
Package Size | 10ug/50ug/100ug/1mg |
Other Names | ALK-6; ALK6; AMD3; AMDD; BDA1D; BDA2; CDw293 |
Protein & NCBI Number | O00238, NM_001256793.2 |
Host | E.coli |
Express Region | 1-532aa |
Protein Length | Total length of the protein(including Tag) |
Protein Sequence | MGWLEELNWQLHIFLLILLSMHTRANFLDNMLLRSAGKLNVGTK KEDGESTAPTPRPKVLRCKCHHHCPEDSVNNICSTDGYCFTMIEEDDSGLPVVTSGCL GLEGSDFQCRDTPIPHQRRSIECCTERNECNKDLHPTLPPLKNRDFVDGPIHHRALLI SVTVCSLLLVLIILFCYFRYKRQETRPRYSIGLEQDETYIPPGESLRDLIEQSQSSGS GSGLPLLVQRTIAKQIQMVKQIGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETE IYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDYLKSTTLDAKSMLKL AYSSVSGLCHLHTEIFSTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVKFISDTN EVDIPPNTRVGTKRYMPPEVLDESLNRNHFQSYIMADMYSFGLILWEVARRCVSGGIV EEYQLPYHDLVPSDPSYEDMREIVCIKKLRPSFPNRWSSDECLRQMGKLMTECWAHNP ASRLTALRVKKTLAKMSESQDIKL |
Molecular Weight | about 60.6kDa |
Fusion Tag | 6×His-SUMO (N-terminus) |
Purity | ≥95% SDS-PAGE |
PhysicalProperty | liquid or lyophilized powder |
Reconstitution | Storage solution: We recommend using PBS or a suitable solvent according to the experimental requirements to prepare 1mg/mL storage solution, aliquot and store at -20 °C. Working solution: According to the experimental requirement, dilute Storage solution. The working solution can be stored at 4°C for 2-3 weeks after dilution. |
Storage & Stability | The shelf life of liquid form is 6 months stored at -20 °C /-80 °C. The shelf life of lyophilized form is 12 months stored at -20 °C /-80 °C. |
Applications | Antibody preparation, immunoassay (ELISA, WB), subcellular localization and interaction protein identification, etc. |
Lead Time | 5 to 10 business days; 2 to 3 days for stock products |
Background |
BMPR1B gene,a member of the bone morphogenetic protein (BMP) receptor family,encodes transmembrane serine/threonine kinases,and binds BMPs. BMPs are members of the TGF-beta superfamily and involved in endochondral bone formation and embryogenesis. These proteins transduce their signals through the formation of heteromeric complexes of 2 different types of serine (threonine) kinase receptors: type I receptors of about 50-55 kD and type II receptors of about 70-80 kD. Type II receptors bind ligands in the absence of type I receptors, but they require their respective type I receptors for signaling, whereas type I receptors require their respective type II receptors for ligand binding. Several transcript variants encoding two different isoforms have been found for this gene. BMPR1A and BMPR1B have overlapping functions. BMPR1A and BMPR1B are expressed during early chondrogenesis in mice and are necessary for chondrogenesis in vivo and crucial for endochondral ossification. Recent studies suggest that stronger BMPR1B signaling, compared with BMPR1A signaling, prevents chondrocyte hypertrophy and acts as a cartilage stabilizer during joint morphogenesis. |